PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID 678456157
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Lamiales; Lentibulariaceae; Utricularia
Family TALE
Protein Properties Length: 543aa    MW: 61048.8 Da    PI: 7.9998
Description TALE family protein
Gene Model
Gene Model ID Type Source Coding Sequence
678456157genomeUGSPView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox29.31.5e-093623991954
                HHH..SSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHH CS
   Homeobox  19 Fek..nrypsaeereeLAkklgLterqVkvWFqNrRak 54 
                Fe   ++yp+ +e+  LA+++gL+++qV++WF N R +
  678456157 362 FEHflHPYPNDSEKLMLASQTGLSKNQVSNWFINARVR 399
                664459******************************88 PP

2BELL88.47.8e-292292911072
       BELL  10 akLlslleeVdkrYkqyveqlqtvissFeavaglgsakpYtslAlkaiSrhFrcLkdaiaeqi 72 
                 kLlslleeV++rY  y+ +l  v+ssFe++aglg+ k+Yt+lAl+a+S+hF +Lk ai++qi
  678456157 229 LKLLSLLEEVERRYDEYHRKLDGVVSSFEIIAGLGAGKSYTALALQAMSKHFAALKKAIVSQI 291
                69************************************************************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM005741.1E-30153289IPR006563POX domain
PfamPF075261.4E-31159288IPR006563POX domain
PROSITE profilePS5007112.05340403IPR001356Homeobox domain
SMARTSM003892.9E-9343407IPR001356Homeobox domain
Gene3DG3DSA:1.10.10.603.2E-27348409IPR009057Homeodomain-like
CDDcd000868.38E-11349404No hitNo description
SuperFamilySSF466892.01E-17349411IPR009057Homeodomain-like
PfamPF059203.9E-17360399IPR008422Homeobox KN domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 543 aa     Download sequence    Send to blast
MVSEDSTNSN SNMLHHFFIT NSIQTQNHFG GDHHHFNAYG ASANSNAAAG HYAHPLHSSI  60
LADRIARSVD LGHAPQMSEE SNMTSVHDTR LMDLLGTSTE ATGPARMLSL SLGSVSCRQR  120
PAMNQAFVDH GCFDSFYAPA SNQCCSTSSY GTESFTAAIG NSKYLKPAQA LLEEMVSVAG  180
KEIDEGNQKF VEELSNNAVK GIYTLSSELR AELSHGELVD EQGTYLNLLK LLSLLEEVER  240
RYDEYHRKLD GVVSSFEIIA GLGAGKSYTA LALQAMSKHF AALKKAIVSQ IRAAKHKIEK  300
EMPKISSRLS QLSLFDQETR HNHNHNRVSL QQLGLLQNSR QAFRPIRGLP ENSVAILRAW  360
LFEHFLHPYP NDSEKLMLAS QTGLSKNQVS NWFINARVRL WKPMIEEMYK DEFGEFSTES  420
DQILLIIHHH HRACFLSSPP SLCQNNKQQY ALRHLSQTSQ DSNQCAFRAF LQLFQTVSTD  480
GDQSSHCRIH LGGLHMGFSK KMILRSETRH RWKQAAMECA AGKQCRQQHH TCNKVRRERD  540
PDK
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
4xrs_B3e-16349406158Homeobox protein Meis1
4xrs_A3e-16349406158Homeobox protein Meis1
4xrm_B4e-16349407563Homeobox protein Meis2
4xrm_A4e-16349407563Homeobox protein Meis2
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_011083617.10.0PREDICTED: BEL1-like homeodomain protein 11
SwissprotQ1PFD13e-89BLH11_ARATH; BEL1-like homeodomain protein 11
TrEMBLS8DPT01e-180S8DPT0_9LAMI; Uncharacterized protein (Fragment)
STRINGVIT_18s0001g13130.t011e-146(Vitis vinifera)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA86022228
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G75430.19e-85BEL1-like homeodomain 11